PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1854500.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 327aa    MW: 37934.4 Da    PI: 6.8671
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1854500.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53.2e-5471351128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPt+eelv +yLk+k+++ k++l +vi evd+yk+ePwd++      +++++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  Lj5g3v1854500.3   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVIVEVDLYKIEPWDIQDrckLGYEQQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKA 99 
                      69****************************.99**************952432234677*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v+s k++ +g++ktLvfykgrap+g+ktdW+mheyr 
  Lj5g3v1854500.3 100 VMS-KNRIIGMRKTLVFYKGRAPNGRKTDWIMHEYRH 135
                      ***.8999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-605156IPR003441NAC domain
PROSITE profilePS5100557.7667156IPR003441NAC domain
PfamPF023653.1E-288134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDMESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIV EVDLYKIEPW DIQDRCKLGY  60
EQQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAV MSKNRIIGMR KTLVFYKGRA  120
PNGRKTDWIM HEYRHQTSEH GPPQEEGWVV CRAFRKPSPS HRQGFESWCT NQPQFFRDHH  180
HQSYTRPLSI TDILNETNNV LHPAEGTSYS SHPFSSEQPF LPNQTVMDKQ QLIELPQLDS  240
PTASLALNEQ RLNGLTTNED HCSDERSNNS GQVGIDWKSL DSLFTSQFTD TTNYFSHPHN  300
LPMMVPHGHE LQPQNQPNHV LGCFPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-49716217171NO APICAL MERISTEM PROTEIN
1ut4_B7e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_A7e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_B7e-49716217171NO APICAL MERISTEM PROTEIN
3swm_A6e-49716220174NAC domain-containing protein 19
3swm_B6e-49716220174NAC domain-containing protein 19
3swm_C6e-49716220174NAC domain-containing protein 19
3swm_D6e-49716220174NAC domain-containing protein 19
3swp_A6e-49716220174NAC domain-containing protein 19
3swp_B6e-49716220174NAC domain-containing protein 19
3swp_C6e-49716220174NAC domain-containing protein 19
3swp_D6e-49716220174NAC domain-containing protein 19
3ulx_A7e-49215610168Stress-induced transcription factor NAC1
4dul_A7e-49716217171NAC domain-containing protein 19
4dul_B7e-49716217171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-94AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606215.10.0PREDICTED: NAC domain-containing protein 30-like
SwissprotQ9C8W91e-116NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0R0ECI90.0A0A0R0ECI9_SOYBN; Uncharacterized protein
STRINGGLYMA20G31551.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-106vascular related NAC-domain protein 7